Recombinant Human MEIOC Protein, GST-tagged
| Cat.No. : | MEIOC-4319H |
| Product Overview : | Human FLJ35848 full-length ORF ( NP_001028831.1, 1 a.a. - 622 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MEIOC (Meiosis Specific With Coiled-Coil Domain) is a Protein Coding gene. |
| Molecular Mass : | 97.2 kDa |
| AA Sequence : | MEKQYLRNSNLTPQQKIDELHHGFTGLDLEEQWMYPSRSDHSNCHNIQTNDTAKTTFQEYPLIKNCFTPQTGLSDIMKESGVDIYHYGRDRICTKGLEAPLQQKRAEMFLSQFNRYTENVDYCRYPEYVHPNKAKLNKCSNFSVQDSKKLANGTPETPTVEADTYTKLFQVKPANQKKMEETIPDQQNFTFPKTTPHLTEKQFAKEAVFTADFGLTSEYGLKPHTACPANDFANVTEKQQFAKPDPPHSEYFKSVNLLSNSATSSGGINLNRPTWMNVQTKNNTPIPYRNQGNLMKLNSHLSAASKGSNHSSDFPQLSSTNLTPNSNLFQKYCQENPSAFSSFDFSYSGAERIQSVNHIEGLTKPGEENLFKLVTDKKIKQPNGFCDNYSAQKYGIIENVNKHNFQAKPQSGHYDPEEGPKHLDGLSQNTYQDLLESQGHSNSHRTRGGDNSRVNRTQVSCFSNNYMMGDLRHNQCFQQLGSNGFPLRSTHPFGHSVVPLLDSYDLLSYDDLSHLYPYFNMMYGDNSFSGLMPTFGFQRPIKTRSGPASELHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNPSRVDRLIVDELRELARVSCKNR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MEIOC meiosis specific with coiled-coil domain [ Homo sapiens (human) ] |
| Official Symbol | MEIOC |
| Synonyms | MEIOC; meiosis specific with coiled-coil domain; C17orf104; meiosis-specific coiled-coil domain-containing protein MEIOC; meiosis-specific with coiled-coil domain protein |
| Gene ID | 284071 |
| mRNA Refseq | NM_001145080 |
| Protein Refseq | NP_001138552 |
| MIM | 616934 |
| UniProt ID | A2RUB1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEIOC Products
Required fields are marked with *
My Review for All MEIOC Products
Required fields are marked with *
