Recombinant Human MGAT4EP Protein, GST-tagged

• Cat.No.: MGAT4EP-4764H
• Product Overview: Human LOC641515 full-length ORF ( AAH31277.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MGAT4EP (MGAT4 Family Member E, Pseudogene) is a Pseudogene.
• Molecular Mass: 44.3 kDa
• AA Sequence: MKKQGVSPKPLQSSRPSQSKRRCGPPPFPPASAPEPEVEEVEKSALGGGRSFRRRIRNVENRKGLELKVVAKTLLLGPFLLVRNSLAQLREEVHELQAWWFPSRTTLDFAVLVAYLHWLHLVKLCENYRHFSHLSSLEREMTFCTKMVRFLLLTN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MGAT4EP MGAT4 family member E, pseudogene [ Homo sapiens (human) ]
• Official Symbol: MGAT4EP
• Synonyms: MGAT4EP; MGAT4 family member E, pseudogene; alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein pseudogene
• Gene ID: 641515