Recombinant Human MGAT4EP Protein, GST-tagged

Cat.No. : MGAT4EP-4764H
Product Overview : Human LOC641515 full-length ORF ( AAH31277.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MGAT4EP (MGAT4 Family Member E, Pseudogene) is a Pseudogene.
Molecular Mass : 44.3 kDa
AA Sequence : MKKQGVSPKPLQSSRPSQSKRRCGPPPFPPASAPEPEVEEVEKSALGGGRSFRRRIRNVENRKGLELKVVAKTLLLGPFLLVRNSLAQLREEVHELQAWWFPSRTTLDFAVLVAYLHWLHLVKLCENYRHFSHLSSLEREMTFCTKMVRFLLLTN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MGAT4EP MGAT4 family member E, pseudogene [ Homo sapiens (human) ]
Official Symbol MGAT4EP
Synonyms MGAT4EP; MGAT4 family member E, pseudogene; alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein pseudogene
Gene ID 641515

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MGAT4EP Products

Required fields are marked with *

My Review for All MGAT4EP Products

Required fields are marked with *

0
cart-icon
0
compare icon