Recombinant Human MIOX Protein, GST-tagged
Cat.No. : | MIOX-5346H |
Product Overview : | Human MIOX full-length ORF ( CAK54459.1, 1 a.a. - 285 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MIOX (Myo-Inositol Oxygenase) is a Protein Coding gene. Among its related pathways are Inositol phosphate metabolism (KEGG) and Porphyrin and chlorophyll metabolism. GO annotations related to this gene include iron ion binding and oxidoreductase activity, acting on NAD(P)H. |
Molecular Mass : | 57.75 kDa |
AA Sequence : | MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MIOX myo-inositol oxygenase [ Homo sapiens ] |
Official Symbol | MIOX |
Synonyms | MIOX; myo-inositol oxygenase; aldehyde reductase (aldose reductase) like 6 , ALDRL6; inositol oxygenase; kidney specific protein 32; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; aldehyde reductase (aldose reductase) like 6; ALDRL6; MGC90217; |
Gene ID | 55586 |
mRNA Refseq | NM_017584 |
Protein Refseq | NP_060054 |
MIM | 606774 |
UniProt ID | Q9UGB7 |
◆ Recombinant Proteins | ||
MIOX-6266HF | Recombinant Full Length Human MIOX Protein, GST-tagged | +Inquiry |
MIOX-1477HFL | Recombinant Full Length Human MIOX Protein, C-Flag-tagged | +Inquiry |
MIOX-3689R | Recombinant Rat MIOX Protein | +Inquiry |
Miox-4077M | Recombinant Mouse Miox Protein, Myc/DDK-tagged | +Inquiry |
MIOX-888H | Recombinant Human MIOX Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIOX-4311HCL | Recombinant Human MIOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIOX Products
Required fields are marked with *
My Review for All MIOX Products
Required fields are marked with *