Recombinant Human MIOX Protein, GST-tagged

Cat.No. : MIOX-5346H
Product Overview : Human MIOX full-length ORF ( CAK54459.1, 1 a.a. - 285 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MIOX (Myo-Inositol Oxygenase) is a Protein Coding gene. Among its related pathways are Inositol phosphate metabolism (KEGG) and Porphyrin and chlorophyll metabolism. GO annotations related to this gene include iron ion binding and oxidoreductase activity, acting on NAD(P)H.
Molecular Mass : 57.75 kDa
AA Sequence : MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MIOX myo-inositol oxygenase [ Homo sapiens ]
Official Symbol MIOX
Synonyms MIOX; myo-inositol oxygenase; aldehyde reductase (aldose reductase) like 6 , ALDRL6; inositol oxygenase; kidney specific protein 32; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; aldehyde reductase (aldose reductase) like 6; ALDRL6; MGC90217;
Gene ID 55586
mRNA Refseq NM_017584
Protein Refseq NP_060054
MIM 606774
UniProt ID Q9UGB7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIOX Products

Required fields are marked with *

My Review for All MIOX Products

Required fields are marked with *

0
cart-icon