Recombinant Human MIOX protein, His-tagged
| Cat.No. : | MIOX-885H |
| Product Overview : | Recombinant Human MIOX protein(1-285 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-285 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | MIOX |
| Synonyms | MIOX; myo-inositol oxygenase; aldehyde reductase (aldose reductase) like 6 , ALDRL6; inositol oxygenase; kidney specific protein 32; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; aldehyde reductase (aldose reductase) like 6; ALDRL6; MGC90217; |
| Gene ID | 55586 |
| mRNA Refseq | NM_017584 |
| Protein Refseq | NP_060054 |
| MIM | 606774 |
| UniProt ID | Q9UGB7 |
| ◆ Recombinant Proteins | ||
| MIOX-5346H | Recombinant Human MIOX Protein, GST-tagged | +Inquiry |
| MIOX-3345R | Recombinant Rat MIOX Protein, His (Fc)-Avi-tagged | +Inquiry |
| MIOX-889H | Recombinant Human MIOX Protein, MYC/DDK-tagged | +Inquiry |
| MIOX-9849M | Recombinant Mouse MIOX Protein | +Inquiry |
| MIOX-885H | Recombinant Human MIOX protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIOX-4311HCL | Recombinant Human MIOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIOX Products
Required fields are marked with *
My Review for All MIOX Products
Required fields are marked with *
