Recombinant Human MIOX protein, His-tagged

Cat.No. : MIOX-885H
Product Overview : Recombinant Human MIOX protein(1-285 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-285 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol MIOX
Synonyms MIOX; myo-inositol oxygenase; aldehyde reductase (aldose reductase) like 6 , ALDRL6; inositol oxygenase; kidney specific protein 32; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; aldehyde reductase (aldose reductase) like 6; ALDRL6; MGC90217;
Gene ID 55586
mRNA Refseq NM_017584
Protein Refseq NP_060054
MIM 606774
UniProt ID Q9UGB7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIOX Products

Required fields are marked with *

My Review for All MIOX Products

Required fields are marked with *

0
cart-icon
0
compare icon