Recombinant Human MIOX Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MIOX-1888H
Product Overview : MIOX MS Standard C13 and N15-labeled recombinant protein (NP_060054) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Belongs to the myo-inositol oxygenase family.
Molecular Mass : 33 kDa
AA Sequence : MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MIOX myo-inositol oxygenase [ Homo sapiens (human) ]
Official Symbol MIOX
Synonyms MIOX; myo-inositol oxygenase; aldehyde reductase (aldose reductase) like 6, ALDRL6; inositol oxygenase; kidney specific protein 32; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; aldehyde reductase (aldose reductase) like 6; ALDRL6; MGC90217;
Gene ID 55586
mRNA Refseq NM_017584
Protein Refseq NP_060054
MIM 606774
UniProt ID Q9UGB7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIOX Products

Required fields are marked with *

My Review for All MIOX Products

Required fields are marked with *

0
cart-icon
0
compare icon