Recombinant Human MIOX Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MIOX-1888H
• Product Overview: MIOX MS Standard C13 and N15-labeled recombinant protein (NP_060054) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Belongs to the myo-inositol oxygenase family.
• Molecular Mass: 33 kDa
• AA Sequence: MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MIOX myo-inositol oxygenase [ Homo sapiens (human) ]
• Official Symbol: MIOX
• Synonyms: MIOX; myo-inositol oxygenase; aldehyde reductase (aldose reductase) like 6, ALDRL6; inositol oxygenase; kidney specific protein 32; MI oxygenase; aldehyde reductase-like 6; kidney-specific protein 32; renal-specific oxidoreductase; aldehyde reductase (aldose reductase) like 6; ALDRL6; MGC90217
• Gene ID: 55586
• mRNA Refseq: NM_017584
• Protein Refseq: NP_060054
• MIM: 606774
• UniProt ID: Q9UGB7