Recombinant Full Length Human MIOX Protein, C-Flag-tagged
Cat.No. : | MIOX-1477HFL |
Product Overview : | Recombinant Full Length Human MIOX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables ferric iron binding activity and inositol oxygenase activity. Involved in inositol catabolic process. Predicted to be located in cytoplasm and inclusion body. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.8 kDa |
AA Sequence : | MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKK MTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVV GDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLP PEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCP GILSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Ascorbate and aldarate metabolism, Inositol phosphate metabolism |
Full Length : | Full L. |
Gene Name | MIOX myo-inositol oxygenase [ Homo sapiens (human) ] |
Official Symbol | MIOX |
Synonyms | ALDRL6 |
Gene ID | 55586 |
mRNA Refseq | NM_017584.6 |
Protein Refseq | NP_060054.4 |
MIM | 606774 |
UniProt ID | Q9UGB7 |
◆ Recombinant Proteins | ||
MIOX-1477HFL | Recombinant Full Length Human MIOX Protein, C-Flag-tagged | +Inquiry |
MIOX-885H | Recombinant Human MIOX protein, His-tagged | +Inquiry |
MIOX-1888H | Recombinant Human MIOX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Miox-4077M | Recombinant Mouse Miox Protein, Myc/DDK-tagged | +Inquiry |
MIOX-6266HF | Recombinant Full Length Human MIOX Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIOX-4311HCL | Recombinant Human MIOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIOX Products
Required fields are marked with *
My Review for All MIOX Products
Required fields are marked with *
0
Inquiry Basket