Recombinant Human MKRN2 Protein, GST-tagged

• Cat.No.: MKRN2-5374H
• Product Overview: Human MKRN2 full-length ORF ( NP_054879.3, 1 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]).[supplied by OMIM
• Molecular Mass: 73.3 kDa
• AA Sequence: MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MKRN2 makorin ring finger protein 2 [ Homo sapiens ]
• Official Symbol: MKRN2
• Synonyms: MKRN2; makorin ring finger protein 2; probable E3 ubiquitin-protein ligase makorin-2; HSPC070; RNF62; RING finger protein 62
• Gene ID: 23609
• mRNA Refseq: NM_014160
• Protein Refseq: NP_054879
• MIM: 608426
• UniProt ID: Q9H000