Recombinant Human MOB1B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MOB1B-6226H
Product Overview : MOBKL1A MS Standard C13 and N15-labeled recombinant protein (NP_775739) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 25.1 kDa
AA Sequence : MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MOB1B MOB kinase activator 1B [ Homo sapiens (human) ]
Official Symbol MOB1B
Synonyms MOB1B; MOB kinase activator 1B; MOB1 Mps One Binder homolog B (yeast), MOB1, Mps One Binder kinase activator like 1A (yeast), MOBKL1A; MOB4A; Mob4A protein; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A; MATS2; MOBKL1A; MGC33910;
Gene ID 92597
mRNA Refseq NM_173468
Protein Refseq NP_775739
MIM 609282
UniProt ID Q7L9L4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOB1B Products

Required fields are marked with *

My Review for All MOB1B Products

Required fields are marked with *

0
cart-icon