Recombinant Human MOB1B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MOB1B-6226H
• Product Overview: MOBKL1A MS Standard C13 and N15-labeled recombinant protein (NP_775739) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 25.1 kDa
• AA Sequence: MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MOB1B MOB kinase activator 1B [ Homo sapiens (human) ]
• Official Symbol: MOB1B
• Synonyms: MOB1B; MOB kinase activator 1B; MOB1 Mps One Binder homolog B (yeast), MOB1, Mps One Binder kinase activator like 1A (yeast), MOBKL1A; MOB4A; Mob4A protein; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A; MATS2; MOBKL1A; MGC33910
• Gene ID: 92597
• mRNA Refseq: NM_173468
• Protein Refseq: NP_775739
• MIM: 609282
• UniProt ID: Q7L9L4