Recombinant Human MOB1B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MOB1B-6226H |
| Product Overview : | MOBKL1A MS Standard C13 and N15-labeled recombinant protein (NP_775739) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Three transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 25.1 kDa |
| AA Sequence : | MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MOB1B MOB kinase activator 1B [ Homo sapiens (human) ] |
| Official Symbol | MOB1B |
| Synonyms | MOB1B; MOB kinase activator 1B; MOB1 Mps One Binder homolog B (yeast), MOB1, Mps One Binder kinase activator like 1A (yeast), MOBKL1A; MOB4A; Mob4A protein; mob1A; mob1 homolog 1A; MOB1 Mps One Binder homolog B; mps one binder kinase activator-like 1A; MOB1, Mps One Binder kinase activator-like 1A; MATS2; MOBKL1A; MGC33910; |
| Gene ID | 92597 |
| mRNA Refseq | NM_173468 |
| Protein Refseq | NP_775739 |
| MIM | 609282 |
| UniProt ID | Q7L9L4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOB1B Products
Required fields are marked with *
My Review for All MOB1B Products
Required fields are marked with *


