Recombinant Human MPP1 protein(11-280 aa), C-His-tagged

• Cat.No.: MPP1-2813H
• Product Overview: Recombinant Human MPP1 protein(Q00013)(11-280 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-280 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: GGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAF

Gene Information

• Gene Name: MPP1 membrane protein, palmitoylated 1, 55kDa [ Homo sapiens ]
• Official Symbol: MPP1
• Synonyms: MPP1; membrane protein, palmitoylated 1, 55kDa; DXS552E, membrane protein, palmitoylated 1 (55kD); 55 kDa erythrocyte membrane protein; PEMP; p55; aging-associated gene 12; migration-related gene 1; erythrocyte membrane protein p55; palmitoylated erythrocyte membrane protein; MRG1; AAG12; EMP55; DXS552E
• Gene ID: 4354
• mRNA Refseq: NM_001166460
• Protein Refseq: NP_001159932
• MIM: 305360
• UniProt ID: Q00013