Recombinant Human MPP1 protein(11-280 aa), C-His-tagged

Cat.No. : MPP1-2813H
Product Overview : Recombinant Human MPP1 protein(Q00013)(11-280 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-280 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : GGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAF
Gene Name MPP1 membrane protein, palmitoylated 1, 55kDa [ Homo sapiens ]
Official Symbol MPP1
Synonyms MPP1; membrane protein, palmitoylated 1, 55kDa; DXS552E, membrane protein, palmitoylated 1 (55kD); 55 kDa erythrocyte membrane protein; PEMP; p55; aging-associated gene 12; migration-related gene 1; erythrocyte membrane protein p55; palmitoylated erythrocyte membrane protein; MRG1; AAG12; EMP55; DXS552E;
Gene ID 4354
mRNA Refseq NM_001166460
Protein Refseq NP_001159932
MIM 305360
UniProt ID Q00013

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPP1 Products

Required fields are marked with *

My Review for All MPP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon