Recombinant Human MRP63 Protein, GST-tagged

Cat.No. : MRPL57-5552H
Product Overview : Human MRP63 full-length ORF ( ABM86207.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein which belongs to an undetermined ribosomal subunit and which seems to be specific to animal mitoribosomes. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 3p, 5q, 8q, 14q, and Y. [provided by RefSeq
Molecular Mass : 37.62 kDa
AA Sequence : MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Gene Name MRPL57 mitochondrial ribosomal protein L57 [ Homo sapiens (human) ]
Official Symbol MRPL57
Synonyms MRPL57; mitochondrial ribosomal protein L57; MRP63; bMRP63; ribosomal protein 63, mitochondrial; hMRP63; mitochondrial large ribosomal subunit protein mL63; mitochondrial ribosomal protein 63; mitochondrial ribosomal protein bMRP63
Gene ID 78988
mRNA Refseq NM_024026
Protein Refseq NP_076931
MIM 611997
UniProt ID Q9BQC6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL57 Products

Required fields are marked with *

My Review for All MRPL57 Products

Required fields are marked with *

0
cart-icon
0
compare icon