Recombinant Human MRP63 Protein, GST-tagged
Cat.No. : | MRPL57-5552H |
Product Overview : | Human MRP63 full-length ORF ( ABM86207.1, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein which belongs to an undetermined ribosomal subunit and which seems to be specific to animal mitoribosomes. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 3p, 5q, 8q, 14q, and Y. [provided by RefSeq |
Molecular Mass : | 37.62 kDa |
AA Sequence : | MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Gene Name | MRPL57 mitochondrial ribosomal protein L57 [ Homo sapiens (human) ] |
Official Symbol | MRPL57 |
Synonyms | MRPL57; mitochondrial ribosomal protein L57; MRP63; bMRP63; ribosomal protein 63, mitochondrial; hMRP63; mitochondrial large ribosomal subunit protein mL63; mitochondrial ribosomal protein 63; mitochondrial ribosomal protein bMRP63 |
Gene ID | 78988 |
mRNA Refseq | NM_024026 |
Protein Refseq | NP_076931 |
MIM | 611997 |
UniProt ID | Q9BQC6 |
◆ Recombinant Proteins | ||
MRPL57-11037Z | Recombinant Zebrafish MRPL57 | +Inquiry |
MRPL57-5552H | Recombinant Human MRP63 Protein, GST-tagged | +Inquiry |
Mrpl57-1792M | Recombinant Mouse Mrpl57 Protein, His-tagged | +Inquiry |
MRPL57-6374HF | Recombinant Full Length Human MRPL57 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL57 Products
Required fields are marked with *
My Review for All MRPL57 Products
Required fields are marked with *