Recombinant Human MRPL11 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MRPL11-5000H
Product Overview : MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_733934) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12.
Molecular Mass : 18 kDa
AA Sequence : MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MRPL11 mitochondrial ribosomal protein L11 [ Homo sapiens (human) ]
Official Symbol MRPL11
Synonyms MRPL11; mitochondrial ribosomal protein L11; 39S ribosomal protein L11, mitochondrial; L11MT; CGI-113; MRP-L11; MGC111024;
Gene ID 65003
mRNA Refseq NM_170738
Protein Refseq NP_733934
MIM 611826
UniProt ID Q9Y3B7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL11 Products

Required fields are marked with *

My Review for All MRPL11 Products

Required fields are marked with *

0
cart-icon
0
compare icon