Recombinant Human MRPL11 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MRPL11-5000H |
Product Overview : | MRPL11 MS Standard C13 and N15-labeled recombinant protein (NP_733934) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12. |
Molecular Mass : | 18 kDa |
AA Sequence : | MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MRPL11 mitochondrial ribosomal protein L11 [ Homo sapiens (human) ] |
Official Symbol | MRPL11 |
Synonyms | MRPL11; mitochondrial ribosomal protein L11; 39S ribosomal protein L11, mitochondrial; L11MT; CGI-113; MRP-L11; MGC111024; |
Gene ID | 65003 |
mRNA Refseq | NM_170738 |
Protein Refseq | NP_733934 |
MIM | 611826 |
UniProt ID | Q9Y3B7 |
◆ Recombinant Proteins | ||
MRPL11-677Z | Recombinant Zebrafish MRPL11 | +Inquiry |
MRPL11-5000H | Recombinant Human MRPL11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MRPL11-3421R | Recombinant Rat MRPL11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL11-1432H | Recombinant Human MRPL11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL11-3762R | Recombinant Rat MRPL11 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL11-4198HCL | Recombinant Human MRPL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPL11 Products
Required fields are marked with *
My Review for All MRPL11 Products
Required fields are marked with *
0
Inquiry Basket