Recombinant Human MRPS6 Protein, GST-tagged
Cat.No. : | MRPS6-5625H |
Product Overview : | Human MRPS6 full-length ORF ( AAH10076, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S6P family. Pseudogenes corresponding to this gene are found on chromosomes 1p and 12q. [provided by RefSeq |
Molecular Mass : | 39.49 kDa |
AA Sequence : | MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS6 mitochondrial ribosomal protein S6 [ Homo sapiens ] |
Official Symbol | MRPS6 |
Synonyms | MRPS6; mitochondrial ribosomal protein S6; C21orf101, chromosome 21 open reading frame 101; 28S ribosomal protein S6, mitochondrial; MRP S6; RPMS6; S6mt; MRP-S6; C21orf101; |
Gene ID | 64968 |
mRNA Refseq | NM_032476 |
Protein Refseq | NP_115865 |
MIM | 611973 |
UniProt ID | P82932 |
◆ Recombinant Proteins | ||
Mrps6-708M | Recombinant Mouse Mrps6 Protein, MYC/DDK-tagged | +Inquiry |
MRPS6-3133C | Recombinant Chicken MRPS6 | +Inquiry |
MRPS6-1042H | Recombinant Human MRPS6, GST-tagged | +Inquiry |
MRPS6-5625H | Recombinant Human MRPS6 Protein, GST-tagged | +Inquiry |
MRPS6-4400Z | Recombinant Zebrafish MRPS6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS6-4132HCL | Recombinant Human MRPS6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS6 Products
Required fields are marked with *
My Review for All MRPS6 Products
Required fields are marked with *
0
Inquiry Basket