Recombinant Human MT1F Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MT1F-2579H
• Product Overview: MT1F MS Standard C13 and N15-labeled recombinant protein (NP_005940) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• Molecular Mass: 6.1 kDa
• AA Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MT1F metallothionein 1F [ Homo sapiens (human) ]
• Official Symbol: MT1F
• Synonyms: MT1F; metallothionein 1F; MT1; metallothionein-1F; MT-1F; MT-IF; metallothionein 1F (functional); metallothionein-IF
• Gene ID: 4494
• mRNA Refseq: NM_005949
• Protein Refseq: NP_005940
• MIM: 156352
• UniProt ID: P04733