Recombinant Human MXI1 protein, GST-tagged MXI1-12H

Recombinant Human MXI1 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MXI1 protein, GST-tagged

Recombinant Human MXI1 protein, GST-tagged

MXI1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MXI1-12H
Product Overview : Recombinant Human MXI1(1 a.a. - 182 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 45.76 kDa
AA Sequence : MPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEE AERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEVDNIST TSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : MXI1 MAX interactor 1 [ Homo sapiens ]
Official Symbol : MXI1
Synonyms : MXI1; MAX interactor 1; MAX interacting protein 1; max-interacting protein 1; bHLHc11; MAD2; MXD2; MXI; MAX dimerization protein 2; Max-related transcription factor; class C basic helix-loop-helix protein 11; MGC43220;
Gene ID : 4601
mRNA Refseq : NM_001008541
Protein Refseq : NP_001008541
MIM : 600020
UniProt ID : P50539
Chromosome Location : 10q24-q25
Function : DNA binding; transcription corepressor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy