Recombinant Human MYL6B protein, His-tagged
| Cat.No. : | MYL6B-6744H |
| Product Overview : | Recombinant Human MYL6B protein(1-208 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-208 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ] |
| Official Symbol | MYL6B |
| Synonyms | MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a; myosin alkali light chain 1 slow a; myosin light chain 1 slow-twitch muscle A isoform; myosin light chain 1, slow-twitch muscle A isoform; smooth muscle and nonmuscle myosin light chain alkali 6B; smooth muscle and non-muscle myosin alkali light chain 6B; myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle; |
| Gene ID | 140465 |
| mRNA Refseq | NM_001199629 |
| Protein Refseq | NP_001186558 |
| MIM | 609930 |
| UniProt ID | P14649 |
| ◆ Recombinant Proteins | ||
| MYL6B-10318M | Recombinant Mouse MYL6B Protein | +Inquiry |
| MYL6B-3623H | Recombinant Human MYL6B, His-tagged | +Inquiry |
| MYL6B-30245TH | Recombinant Human MYL6B, His-tagged | +Inquiry |
| Myl6b-4254M | Recombinant Mouse Myl6b Protein, Myc/DDK-tagged | +Inquiry |
| MYL6B-6744H | Recombinant Human MYL6B protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL6B-4022HCL | Recombinant Human MYL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL6B Products
Required fields are marked with *
My Review for All MYL6B Products
Required fields are marked with *
