Recombinant Human MYL6B Protein, GST-tagged
| Cat.No. : | MYL6B-5380H |
| Product Overview : | Human MLC1SA full-length ORF ( NP_002466.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq |
| Molecular Mass : | 49.2 kDa |
| AA Sequence : | MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ] |
| Official Symbol | MYL6B |
| Synonyms | MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a; myosin alkali light chain 1 slow a; myosin light chain 1 slow-twitch muscle A isoform; myosin light chain 1, slow-twitch muscle A isoform; smooth muscle and nonmuscle myosin light chain alkali 6B; smooth muscle and non-muscle myosin alkali light chain 6B; myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle; |
| Gene ID | 140465 |
| mRNA Refseq | NM_001199629 |
| Protein Refseq | NP_001186558 |
| MIM | 609930 |
| UniProt ID | P14649 |
| ◆ Recombinant Proteins | ||
| MYL6B-4022H | Recombinant Human MYL6B Protein (Lys5-Glu199), N-His tagged | +Inquiry |
| MYL6B-4666H | Recombinant Human MYL6B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MYL6B-6350HF | Recombinant Full Length Human MYL6B Protein, GST-tagged | +Inquiry |
| MYL6B-6743H | Recombinant Human MYL6B protein, GST-tagged | +Inquiry |
| MYL6B-5848M | Recombinant Mouse MYL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL6B-4022HCL | Recombinant Human MYL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL6B Products
Required fields are marked with *
My Review for All MYL6B Products
Required fields are marked with *




