Recombinant Human MYL6B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MYL6B-4666H
Product Overview : MYL6B MS Standard C13 and N15-labeled recombinant protein (NP_002466) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.
Molecular Mass : 22.8 kDa
AA Sequence : MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MYL6B myosin light chain 6B [ Homo sapiens (human) ]
Official Symbol MYL6B
Synonyms MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a; myosin alkali light chain 1 slow a; myosin light chain 1 slow-twitch muscle A isoform; myosin light chain 1, slow-twitch muscle A isoform; smooth muscle and nonmuscle myosin light chain alkali 6B; smooth muscle and non-muscle myosin alkali light chain 6B; myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle;
Gene ID 140465
mRNA Refseq NM_002475
Protein Refseq NP_002466
MIM 609930
UniProt ID P14649

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL6B Products

Required fields are marked with *

My Review for All MYL6B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon