Recombinant Human MYL6B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MYL6B-4666H |
Product Overview : | MYL6B MS Standard C13 and N15-labeled recombinant protein (NP_002466) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 22.8 kDa |
AA Sequence : | MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MYL6B myosin light chain 6B [ Homo sapiens (human) ] |
Official Symbol | MYL6B |
Synonyms | MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a; myosin alkali light chain 1 slow a; myosin light chain 1 slow-twitch muscle A isoform; myosin light chain 1, slow-twitch muscle A isoform; smooth muscle and nonmuscle myosin light chain alkali 6B; smooth muscle and non-muscle myosin alkali light chain 6B; myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle; |
Gene ID | 140465 |
mRNA Refseq | NM_002475 |
Protein Refseq | NP_002466 |
MIM | 609930 |
UniProt ID | P14649 |
◆ Recombinant Proteins | ||
Myl6b-8047R | Recombinant Rat Myl6b protein, His & GST-tagged | +Inquiry |
MYL6B-5848M | Recombinant Mouse MYL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
Myl6b-4254M | Recombinant Mouse Myl6b Protein, Myc/DDK-tagged | +Inquiry |
MYL6B-2924R | Recombinant Rhesus monkey MYL6B Protein, His-tagged | +Inquiry |
MYL6B-30245TH | Recombinant Human MYL6B, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL6B-4022HCL | Recombinant Human MYL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL6B Products
Required fields are marked with *
My Review for All MYL6B Products
Required fields are marked with *