Recombinant Human MYL6B, His-tagged

Cat.No. : MYL6B-30245TH
Product Overview : Recombinant fragment, corresponding to amino acids 42-208 of Human MLC1SA with an N terminal His tag; Predicted MWt 20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 42-208 a.a.
Description : Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 74 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGD GKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKS RRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEG NGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGC INYEAFLKHILSV
Sequence Similarities : Contains 3 EF-hand domains.
Gene Name MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ]
Official Symbol MYL6B
Synonyms MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a;
Gene ID 140465
mRNA Refseq NM_001199629
Protein Refseq NP_001186558
MIM 609930
Uniprot ID P14649
Chromosome Location 12q13.2
Pathway Muscle contraction, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem;
Function calcium ion binding; motor activity; protein binding; structural constituent of muscle;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL6B Products

Required fields are marked with *

My Review for All MYL6B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon