Recombinant Human MYL6B, His-tagged
Cat.No. : | MYL6B-30245TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 42-208 of Human MLC1SA with an N terminal His tag; Predicted MWt 20kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 42-208 a.a. |
Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 74 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGD GKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKS RRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEG NGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGC INYEAFLKHILSV |
Sequence Similarities : | Contains 3 EF-hand domains. |
Gene Name | MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ] |
Official Symbol | MYL6B |
Synonyms | MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a; |
Gene ID | 140465 |
mRNA Refseq | NM_001199629 |
Protein Refseq | NP_001186558 |
MIM | 609930 |
Uniprot ID | P14649 |
Chromosome Location | 12q13.2 |
Pathway | Muscle contraction, organism-specific biosystem; Smooth Muscle Contraction, organism-specific biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem; |
Function | calcium ion binding; motor activity; protein binding; structural constituent of muscle; |
◆ Recombinant Proteins | ||
Myl6b-4254M | Recombinant Mouse Myl6b Protein, Myc/DDK-tagged | +Inquiry |
MYL6B-6350HF | Recombinant Full Length Human MYL6B Protein, GST-tagged | +Inquiry |
MYL6B-30243TH | Recombinant Human MYL6B, His-tagged | +Inquiry |
MYL6B-30245TH | Recombinant Human MYL6B, His-tagged | +Inquiry |
MYL6B-3623H | Recombinant Human MYL6B, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL6B-4022HCL | Recombinant Human MYL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYL6B Products
Required fields are marked with *
My Review for All MYL6B Products
Required fields are marked with *
0
Inquiry Basket