Recombinant Human MYLPF
Cat.No. : | MYLPF-30272TH |
Product Overview : | Recombinant full length Human MYLPF with a proprietary tag, MWt 44.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 169 amino acids |
Description : | Non muscle Myosins are required for cytokinesis at the end of cell division, when a contractile ring near the plasmalemma divides the cytoplasm of the daughter cells, They are involved in cytoplasmic streaming movements in tissues, and especially in acti |
Molecular Weight : | 44.700kDa inclusive of tags |
Tissue specificity : | Expressed in fetal and adult skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
Sequence Similarities : | Contains 3 EF-hand domains. |
Gene Name | MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ] |
Official Symbol | MYLPF |
Synonyms | MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory; |
Gene ID | 29895 |
mRNA Refseq | NM_013292 |
Protein Refseq | NP_037424 |
Uniprot ID | Q96A32 |
Chromosome Location | 16p11.2 |
Pathway | ErbB1 downstream signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; |
Function | calcium ion binding; structural constituent of muscle; |
◆ Recombinant Proteins | ||
MYLPF-574H | Active Recombinant Human MYLPF | +Inquiry |
MYLPF-30272TH | Recombinant Human MYLPF | +Inquiry |
MYLPF-5827H | Recombinant Human MYLPF Protein, GST-tagged | +Inquiry |
MYLPF-3860R | Recombinant Rat MYLPF Protein | +Inquiry |
MYLPF-4741H | Recombinant Human MYLPF protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYLPF-4013HCL | Recombinant Human MYLPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYLPF Products
Required fields are marked with *
My Review for All MYLPF Products
Required fields are marked with *