Recombinant Full Length Human MYLPF Protein, GST-tagged
| Cat.No. : | MYLPF-6770HF |
| Product Overview : | Human MYLPF full-length ORF ( AAH12571, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 169 amino acids |
| Description : | MYLPF (Myosin Light Chain, Phosphorylatable, Fast Skeletal Muscle) is a Protein Coding gene. Among its related pathways are Focal Adhesion and Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include calcium ion binding and structural constituent of muscle. An important paralog of this gene is MYL10. |
| Molecular Mass : | 44.33 kDa |
| AA Sequence : | MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ] |
| Official Symbol | MYLPF |
| Synonyms | MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory; MLC2B; myosin light chain 2; fast skeletal myosin light chain 2; myosin, light chain 11, regulatory; MGC13450; DKFZp779C0757; |
| Gene ID | 29895 |
| mRNA Refseq | NM_013292 |
| Protein Refseq | NP_037424 |
| MIM | 617378 |
| UniProt ID | Q96A32 |
| ◆ Recombinant Proteins | ||
| MYLPF-4741H | Recombinant Human MYLPF protein, His-SUMO-tagged | +Inquiry |
| MYLPF-10325M | Recombinant Mouse MYLPF Protein | +Inquiry |
| MYLPF-5851M | Recombinant Mouse MYLPF Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYLPF-324HF | Recombinant Full Length Human MYLPF Protein | +Inquiry |
| Mylpf-4259M | Recombinant Mouse Mylpf Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYLPF-4013HCL | Recombinant Human MYLPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYLPF Products
Required fields are marked with *
My Review for All MYLPF Products
Required fields are marked with *



