Recombinant Human MYNN Protein, GST-tagged
Cat.No. : | MYNN-5828H |
Product Overview : | Human MYNN partial ORF ( NP_061127, 501 a.a. - 610 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the BTB/POZ and zinc finger domain-containing protein family that are involved in the control of gene expression. Alternative splicing results in multiple transcript variants and a pseudogene has been identified on chromosome 14. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | CELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYNN myoneurin [ Homo sapiens ] |
Official Symbol | MYNN |
Synonyms | MYNN; myoneurin; SBBIZ1; ZBTB31; ZNF902; zinc finger protein with BTB/POZ domain; zinc finger and BTB domain-containing protein 31; OSZF; |
Gene ID | 55892 |
mRNA Refseq | NM_001185118 |
Protein Refseq | NP_001172047 |
MIM | 606042 |
UniProt ID | Q9NPC7 |
◆ Recombinant Proteins | ||
MYNN-3757H | Recombinant Human MYNN protein, GST-tagged | +Inquiry |
MYNN-5828H | Recombinant Human MYNN Protein, GST-tagged | +Inquiry |
MYNN-10326M | Recombinant Mouse MYNN Protein | +Inquiry |
MYNN-5852M | Recombinant Mouse MYNN Protein, His (Fc)-Avi-tagged | +Inquiry |
MYNN-10157Z | Recombinant Zebrafish MYNN | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYNN-4012HCL | Recombinant Human MYNN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYNN Products
Required fields are marked with *
My Review for All MYNN Products
Required fields are marked with *