Recombinant Human MYNN Protein, GST-tagged

Cat.No. : MYNN-5828H
Product Overview : Human MYNN partial ORF ( NP_061127, 501 a.a. - 610 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the BTB/POZ and zinc finger domain-containing protein family that are involved in the control of gene expression. Alternative splicing results in multiple transcript variants and a pseudogene has been identified on chromosome 14. [provided by RefSeq, Jun 2010]
Molecular Mass : 37.84 kDa
AA Sequence : CELCGNSYTDIKNLKKHKTKVHSGADKTLDSSAEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYNN myoneurin [ Homo sapiens ]
Official Symbol MYNN
Synonyms MYNN; myoneurin; SBBIZ1; ZBTB31; ZNF902; zinc finger protein with BTB/POZ domain; zinc finger and BTB domain-containing protein 31; OSZF;
Gene ID 55892
mRNA Refseq NM_001185118
Protein Refseq NP_001172047
MIM 606042
UniProt ID Q9NPC7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYNN Products

Required fields are marked with *

My Review for All MYNN Products

Required fields are marked with *

0
cart-icon
0
compare icon