Recombinant Human MYO1E Protein, GST-tagged

Cat.No. : MYO1E-5836H
Product Overview : Human MYO1E partial ORF ( NP_004989.2, 918 a.a. - 1014 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the nonmuscle class I myosins which are a subgroup of the unconventional myosin protein family. The unconventional myosin proteins function as actin-based molecular motors. Class I myosins are characterized by a head (motor) domain, a regulatory domain and a either a short or long tail domain. Among the class I myosins, this protein is distinguished by a long tail domain that is involved in crosslinking actin filaments. This protein localizes to the cytoplasm and may be involved in intracellular movement and membrane trafficking. Mutations in this gene are the cause of focal segmental glomerulosclerosis-6. This gene has been referred to as myosin IC in the literature but is distinct from the myosin IC gene located on chromosome 17. [provided by RefSeq, Jan 2012]
Molecular Mass : 36.41 kDa
AA Sequence : VSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYO1E myosin IE [ Homo sapiens (human) ]
Official Symbol MYO1E
Synonyms MYO1E myosin IE; unconventional myosin-Ie; MYO1E variant protein; myosin-IC; unconventional myosin 1E; FSGS6; MYO1C; HuncM-IC
Gene ID 4643
mRNA Refseq NM_004998
Protein Refseq NP_004989
MIM 601479
UniProt ID Q12965

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYO1E Products

Required fields are marked with *

My Review for All MYO1E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon