Recombinant Human MYO7A Protein, GST-tagged
Cat.No. : | MYO7A-5844H |
Product Overview : | Human MYO7A partial ORF ( NP_000251, 2118 a.a. - 2213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the myosin gene family. Myosins are mechanochemical proteins characterized by the presence of a motor domain, an actin-binding domain, a neck domain that interacts with other proteins, and a tail domain that serves as an anchor. This gene encodes an unconventional myosin with a very short tail. Defects in this gene are associated with the mouse shaker-1 phenotype and the human Usher syndrome 1B which are characterized by deafness, reduced vestibular function, and (in human) retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
Molecular Mass : | 36.3 kDa |
AA Sequence : | KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYO7A myosin VIIA [ Homo sapiens ] |
Official Symbol | MYO7A |
Synonyms | MYO7A; myosin VIIA; DFNA11, DFNB2, myosin VIIA (Usher syndrome 1B (autosomal recessive, severe)) , USH1B; unconventional myosin-VIIa; NSRD2; myosin-VIIa; myosin VIIA (Usher syndrome 1B (autosomal recessive, severe)); DFNB2; MYU7A; USH1B; DFNA11; MYOVIIA; |
Gene ID | 4647 |
mRNA Refseq | NM_000260 |
Protein Refseq | NP_000251 |
MIM | 276903 |
UniProt ID | Q13402 |
◆ Recombinant Proteins | ||
MYO7A-10344M | Recombinant Mouse MYO7A Protein | +Inquiry |
MYO7A-5861M | Recombinant Mouse MYO7A Protein, His (Fc)-Avi-tagged | +Inquiry |
MYO7A-2026H | Recombinant Human MYO7A Protein (838-968 aa), His-SUMO-tagged | +Inquiry |
MYO7A-2471H | Recombinant Human MYO7A Protein, His-tagged | +Inquiry |
MYO7A-5844H | Recombinant Human MYO7A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYO7A Products
Required fields are marked with *
My Review for All MYO7A Products
Required fields are marked with *
0
Inquiry Basket