Recombinant Human MYOF Protein, GST-tagged
| Cat.No. : | MYOF-4074H |
| Product Overview : | Human FER1L3 partial ORF ( NP_038479, 655 a.a. - 754 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length nature has not been determined. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | DAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYOF myoferlin [ Homo sapiens (human) ] |
| Official Symbol | MYOF |
| Synonyms | MYOF; myoferlin; FER1L3; myoferlin; fer-1-like 3, myoferlin; fer-1-like family member 3; fer-1-like protein 3; Myoferlin; Fer-1-Like Family Member 3; Fer-1-Like Protein 3; FER1L3; Fer-1 (C.Elegans)-Like 3 (Myoferlin); Fer-1-Like 3, Myoferlin (C. Elegans); Fer-1-Like 3, Myoferlin; KIAA1207 |
| Gene ID | 26509 |
| mRNA Refseq | NM_013451 |
| Protein Refseq | NP_038479 |
| MIM | 604603 |
| UniProt ID | Q9NZM1 |
| ◆ Recombinant Proteins | ||
| MYOF-10350M | Recombinant Mouse MYOF Protein | +Inquiry |
| MYOF-5866M | Recombinant Mouse MYOF Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYOF-11123Z | Recombinant Zebrafish MYOF | +Inquiry |
| MYOF-12HCL | Recombinant Human MYOF Over-expression cell lysate | +Inquiry |
| MYOF-4074H | Recombinant Human MYOF Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOF Products
Required fields are marked with *
My Review for All MYOF Products
Required fields are marked with *
