Recombinant Human MYOF Protein, GST-tagged

Cat.No. : MYOF-4074H
Product Overview : Human FER1L3 partial ORF ( NP_038479, 655 a.a. - 754 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length nature has not been determined. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : DAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYOF myoferlin [ Homo sapiens (human) ]
Official Symbol MYOF
Synonyms MYOF; myoferlin; FER1L3; myoferlin; fer-1-like 3, myoferlin; fer-1-like family member 3; fer-1-like protein 3; Myoferlin; Fer-1-Like Family Member 3; Fer-1-Like Protein 3; FER1L3; Fer-1 (C.Elegans)-Like 3 (Myoferlin); Fer-1-Like 3, Myoferlin (C. Elegans); Fer-1-Like 3, Myoferlin; KIAA1207
Gene ID 26509
mRNA Refseq NM_013451
Protein Refseq NP_038479
MIM 604603
UniProt ID Q9NZM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYOF Products

Required fields are marked with *

My Review for All MYOF Products

Required fields are marked with *

0
cart-icon
0
compare icon