Recombinant Human MYOM3 Protein, GST-tagged

Cat.No. : MYOM3-5855H
Product Overview : Human MYOM3 partial ORF ( NP_689585, 854 a.a. - 955 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MYOM3 (Myomesin 3) is a Protein Coding gene. GO annotations related to this gene include protein homodimerization activity. An important paralog of this gene is MYOM2.
Molecular Mass : 36.96 kDa
AA Sequence : GPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYOM3 myomesin 3 [ Homo sapiens (human) ]
Official Symbol MYOM3
Synonyms MYOM3; myomesin 3; myomesin-3; myomesin family, member 3
Gene ID 127294
mRNA Refseq NM_152372
Protein Refseq NP_689585
MIM 616832
UniProt ID Q5VTT5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYOM3 Products

Required fields are marked with *

My Review for All MYOM3 Products

Required fields are marked with *

0
cart-icon