Recombinant Human MYOM3 Protein, GST-tagged
Cat.No. : | MYOM3-5855H |
Product Overview : | Human MYOM3 partial ORF ( NP_689585, 854 a.a. - 955 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MYOM3 (Myomesin 3) is a Protein Coding gene. GO annotations related to this gene include protein homodimerization activity. An important paralog of this gene is MYOM2. |
Molecular Mass : | 36.96 kDa |
AA Sequence : | GPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYOM3 myomesin 3 [ Homo sapiens (human) ] |
Official Symbol | MYOM3 |
Synonyms | MYOM3; myomesin 3; myomesin-3; myomesin family, member 3 |
Gene ID | 127294 |
mRNA Refseq | NM_152372 |
Protein Refseq | NP_689585 |
MIM | 616832 |
UniProt ID | Q5VTT5 |
◆ Recombinant Proteins | ||
MYOM3-5869M | Recombinant Mouse MYOM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOM3-3802H | Recombinant Human MYOM3 Protein (Ser888-Glu1178), N-His tagged | +Inquiry |
MYOM3-1149H | Recombinant Human MYOM3, His-tagged | +Inquiry |
MYOM3-5855H | Recombinant Human MYOM3 Protein, GST-tagged | +Inquiry |
MYOM3-10354M | Recombinant Mouse MYOM3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOM3 Products
Required fields are marked with *
My Review for All MYOM3 Products
Required fields are marked with *