Recombinant Human N4BP2L1 Protein, GST-Tagged
| Cat.No. : | N4BP2L1-1315H |
| Product Overview : | Human CG018 full-length ORF (NP_001073159.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | N4BP2L1 (NEDD4 Binding Protein 2 Like 1) is a Protein Coding gene. GO annotations related to this gene include kinase activity. An important paralog of this gene is N4BP2. |
| Molecular Mass : | 47.1 kDa |
| AA Sequence : | MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMVFQTEQKNLFRLEMDMVVFRPEMKKHSWCLKRKNPPNERTV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | N4BP2L1 NEDD4 binding protein 2-like 1 [ Homo sapiens ] |
| Official Symbol | N4BP2L1 |
| Synonyms | CG018 |
| Gene ID | 90634 |
| mRNA Refseq | NM_052818 |
| Protein Refseq | NP_438169 |
| UniProt ID | Q5TBK1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All N4BP2L1 Products
Required fields are marked with *
My Review for All N4BP2L1 Products
Required fields are marked with *



