Recombinant Human N4BP2L1 Protein, GST-Tagged

Cat.No. : N4BP2L1-1315H
Product Overview : Human CG018 full-length ORF (NP_001073159.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : N4BP2L1 (NEDD4 Binding Protein 2 Like 1) is a Protein Coding gene. GO annotations related to this gene include kinase activity. An important paralog of this gene is N4BP2.
Molecular Mass : 47.1 kDa
AA Sequence : MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTNLHAWEMKPYAVMVFQTEQKNLFRLEMDMVVFRPEMKKHSWCLKRKNPPNERTV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name N4BP2L1 NEDD4 binding protein 2-like 1 [ Homo sapiens ]
Official Symbol N4BP2L1
Synonyms CG018
Gene ID 90634
mRNA Refseq NM_052818
Protein Refseq NP_438169
UniProt ID Q5TBK1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All N4BP2L1 Products

Required fields are marked with *

My Review for All N4BP2L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon