Recombinant Human NAV1 protein, His-tagged

• Cat.No.: NAV1-1198H
• Product Overview: Recombinant Human NAV1 protein(1359-1530 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1359-1530 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: LKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIHGYSISHVKRVLDAEPPEMPPCRRGVNNISVSLKGLKEKCVDSL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NAV1 neuron navigator 1 [ Homo sapiens ]
• Official Symbol: NAV1
• Synonyms: NAV1; neuron navigator 1; DKFZp781D0314; FLJ12560; FLJ14203; KIAA1151; MGC14961; POMFIL3; pore membrane and/or filament interacting like protein 3; steerin 1; unc-53 homolog 1; neuron navigator-1; pore membrane and/or filament-interacting-like protein 3; UNC53H1; STEERIN1
• Gene ID: 89796
• mRNA Refseq: NM_001167738
• Protein Refseq: NP_001161210
• MIM: 611628
• UniProt ID: Q8NEY1