Recombinant Human NCAPD2 Protein, GST-tagged

Cat.No. : NCAPD2-1550H
Product Overview : Human CNAP1 partial ORF ( AAH28182, 1240 a.a. - 1339 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NCAPD2 (Non-SMC Condensin I Complex Subunit D2) is a Protein Coding gene. Among its related pathways are Aurora B signaling and Mitotic Prometaphase. GO annotations related to this gene include binding and histone binding.
Molecular Mass : 36.63 kDa
AA Sequence : LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NCAPD2 non-SMC condensin I complex, subunit D2 [ Homo sapiens ]
Official Symbol NCAPD2
Synonyms NCAPD2; non-SMC condensin I complex, subunit D2; condensin complex subunit 1; CAP D2; chromosome condensation related SMC associated protein 1; CNAP1; hCAP D2; KIAA0159; XCAP-D2 homolog; chromosome-associated protein D2; chromosome condensation-related SMC-associated protein 1; CAP-D2; hCAP-D2;
Gene ID 9918
mRNA Refseq NM_014865
Protein Refseq NP_055680
MIM 615638
UniProt ID Q15021

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCAPD2 Products

Required fields are marked with *

My Review for All NCAPD2 Products

Required fields are marked with *

0
cart-icon