Recombinant Human NCAPD2 Protein, GST-tagged

• Cat.No.: NCAPD2-1550H
• Product Overview: Human CNAP1 partial ORF ( AAH28182, 1240 a.a. - 1339 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NCAPD2 (Non-SMC Condensin I Complex Subunit D2) is a Protein Coding gene. Among its related pathways are Aurora B signaling and Mitotic Prometaphase. GO annotations related to this gene include binding and histone binding.
• Molecular Mass: 36.63 kDa
• AA Sequence: LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NCAPD2 non-SMC condensin I complex, subunit D2 [ Homo sapiens ]
• Official Symbol: NCAPD2
• Synonyms: NCAPD2; non-SMC condensin I complex, subunit D2; condensin complex subunit 1; CAP D2; chromosome condensation related SMC associated protein 1; CNAP1; hCAP D2; KIAA0159; XCAP-D2 homolog; chromosome-associated protein D2; chromosome condensation-related SMC-associated protein 1; CAP-D2; hCAP-D2
• Gene ID: 9918
• mRNA Refseq: NM_014865
• Protein Refseq: NP_055680
• MIM: 615638
• UniProt ID: Q15021