Recombinant Human NCAPD2 Protein, GST-tagged
Cat.No. : | NCAPD2-1550H |
Product Overview : | Human CNAP1 partial ORF ( AAH28182, 1240 a.a. - 1339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NCAPD2 (Non-SMC Condensin I Complex Subunit D2) is a Protein Coding gene. Among its related pathways are Aurora B signaling and Mitotic Prometaphase. GO annotations related to this gene include binding and histone binding. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NCAPD2 non-SMC condensin I complex, subunit D2 [ Homo sapiens ] |
Official Symbol | NCAPD2 |
Synonyms | NCAPD2; non-SMC condensin I complex, subunit D2; condensin complex subunit 1; CAP D2; chromosome condensation related SMC associated protein 1; CNAP1; hCAP D2; KIAA0159; XCAP-D2 homolog; chromosome-associated protein D2; chromosome condensation-related SMC-associated protein 1; CAP-D2; hCAP-D2; |
Gene ID | 9918 |
mRNA Refseq | NM_014865 |
Protein Refseq | NP_055680 |
MIM | 615638 |
UniProt ID | Q15021 |
◆ Recombinant Proteins | ||
NCAPD2-3619C | Recombinant Chicken NCAPD2 | +Inquiry |
NCAPD2-1550H | Recombinant Human NCAPD2 Protein, GST-tagged | +Inquiry |
NCAPD2-10456M | Recombinant Mouse NCAPD2 Protein | +Inquiry |
NCAPD2-7536Z | Recombinant Zebrafish NCAPD2 | +Inquiry |
NCAPD2-5930M | Recombinant Mouse NCAPD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCAPD2-372HCL | Recombinant Human NCAPD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCAPD2 Products
Required fields are marked with *
My Review for All NCAPD2 Products
Required fields are marked with *