Recombinant Human NCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NCBP2-468H |
Product Overview : | NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001036005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 11.8 kDa |
AA Sequence : | MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NCBP2 nuclear cap binding protein subunit 2 [ Homo sapiens (human) ] |
Official Symbol | NCBP2 |
Synonyms | NCBP2; nuclear cap binding protein subunit 2, 20kDa; nuclear cap binding protein subunit 2, 20kD; nuclear cap-binding protein subunit 2; Cbc2; CBP20; NIP1; NCBP 20 kDa subunit; NCBP interacting protein 1; NCBP-interacting protein 1; 20 kDa nuclear cap-binding protein; cell proliferation-inducing gene 55 protein; CBC2; PIG55; |
Gene ID | 22916 |
mRNA Refseq | NM_001042540 |
Protein Refseq | NP_001036005 |
MIM | 605133 |
UniProt ID | P52298 |
◆ Recombinant Proteins | ||
Ncbp2-4305M | Recombinant Mouse Ncbp2 Protein, Myc/DDK-tagged | +Inquiry |
NCBP2-468H | Recombinant Human NCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NCBP2-10463M | Recombinant Mouse NCBP2 Protein | +Inquiry |
NCBP2-4853C | Recombinant Chicken NCBP2 | +Inquiry |
NCBP2-5933M | Recombinant Mouse NCBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCBP2-3952HCL | Recombinant Human NCBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCBP2 Products
Required fields are marked with *
My Review for All NCBP2 Products
Required fields are marked with *
0
Inquiry Basket