Recombinant Human NCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NCBP2-468H |
| Product Overview : | NCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001036005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 11.8 kDa |
| AA Sequence : | MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NCBP2 nuclear cap binding protein subunit 2 [ Homo sapiens (human) ] |
| Official Symbol | NCBP2 |
| Synonyms | NCBP2; nuclear cap binding protein subunit 2, 20kDa; nuclear cap binding protein subunit 2, 20kD; nuclear cap-binding protein subunit 2; Cbc2; CBP20; NIP1; NCBP 20 kDa subunit; NCBP interacting protein 1; NCBP-interacting protein 1; 20 kDa nuclear cap-binding protein; cell proliferation-inducing gene 55 protein; CBC2; PIG55; |
| Gene ID | 22916 |
| mRNA Refseq | NM_001042540 |
| Protein Refseq | NP_001036005 |
| MIM | 605133 |
| UniProt ID | P52298 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCBP2 Products
Required fields are marked with *
My Review for All NCBP2 Products
Required fields are marked with *



