Recombinant Human NEK7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NEK7-1323H
• Product Overview: NEK7 MS Standard C13 and N15-labeled recombinant protein (NP_598001) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.
• Molecular Mass: 34.4 kDa
• AA Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NEK7 NIMA related kinase 7 [ Homo sapiens (human) ]
• Official Symbol: NEK7
• Synonyms: NEK7; NIMA (never in mitosis gene a)-related kinase 7; serine/threonine-protein kinase Nek7; nimA-related protein kinase 7; never in mitosis A-related kinase 7
• Gene ID: 140609
• mRNA Refseq: NM_133494
• Protein Refseq: NP_598001
• MIM: 606848
• UniProt ID: Q8TDX7