Recombinant Human NEK7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NEK7-1323H
Product Overview : NEK7 MS Standard C13 and N15-labeled recombinant protein (NP_598001) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NIMA-related kinases share high amino acid sequence identity with the gene product of the Aspergillus nidulans 'never in mitosis A' gene, which controls initiation of mitosis.
Molecular Mass : 34.4 kDa
AA Sequence : MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NEK7 NIMA related kinase 7 [ Homo sapiens (human) ]
Official Symbol NEK7
Synonyms NEK7; NIMA (never in mitosis gene a)-related kinase 7; serine/threonine-protein kinase Nek7; nimA-related protein kinase 7; never in mitosis A-related kinase 7;
Gene ID 140609
mRNA Refseq NM_133494
Protein Refseq NP_598001
MIM 606848
UniProt ID Q8TDX7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NEK7 Products

Required fields are marked with *

My Review for All NEK7 Products

Required fields are marked with *

0
cart-icon
0
compare icon