Recombinant Human NELL2
Cat.No. : | NELL2-29302TH |
Product Overview : | Recombinant fragment of Human NELL2 with N terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF |
Sequence Similarities : | Contains 6 EGF-like domains.Contains 1 TSP N-terminal (TSPN) domain.Contains 5 VWFC domains. |
Gene Name | NELL2 NEL-like 2 (chicken) [ Homo sapiens ] |
Official Symbol | NELL2 |
Synonyms | NELL2; NEL-like 2 (chicken); nel (chicken) like 2; protein kinase C-binding protein NELL2; NRP2; |
Gene ID | 4753 |
mRNA Refseq | NM_001145107 |
Protein Refseq | NP_001138579 |
MIM | 602320 |
Uniprot ID | Q99435 |
Chromosome Location | 12q12 |
Function | calcium ion binding; calcium ion binding; protein binding; structural molecule activity; structural molecule activity; |
◆ Recombinant Proteins | ||
NELL2-2820R | Recombinant Rhesus Macaque NELL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NELL2-3001R | Recombinant Rhesus monkey NELL2 Protein, His-tagged | +Inquiry |
NELL2-1262H | Recombinant Human NELL2, GST-tagged | +Inquiry |
NELL2-1915H | Recombinant Human NELL2 protein, His & T7-tagged | +Inquiry |
Nell2-4374M | Recombinant Mouse Nell2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NELL2-468HCL | Recombinant Human NELL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NELL2 Products
Required fields are marked with *
My Review for All NELL2 Products
Required fields are marked with *