Recombinant Human NELL2

Cat.No. : NELL2-29302TH
Product Overview : Recombinant fragment of Human NELL2 with N terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF
Sequence Similarities : Contains 6 EGF-like domains.Contains 1 TSP N-terminal (TSPN) domain.Contains 5 VWFC domains.
Gene Name NELL2 NEL-like 2 (chicken) [ Homo sapiens ]
Official Symbol NELL2
Synonyms NELL2; NEL-like 2 (chicken); nel (chicken) like 2; protein kinase C-binding protein NELL2; NRP2;
Gene ID 4753
mRNA Refseq NM_001145107
Protein Refseq NP_001138579
MIM 602320
Uniprot ID Q99435
Chromosome Location 12q12
Function calcium ion binding; calcium ion binding; protein binding; structural molecule activity; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NELL2 Products

Required fields are marked with *

My Review for All NELL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon