Recombinant Human NELL2

• Cat.No.: NELL2-29302TH
• Product Overview: Recombinant fragment of Human NELL2 with N terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF
• Sequence Similarities: Contains 6 EGF-like domains.Contains 1 TSP N-terminal (TSPN) domain.Contains 5 VWFC domains.

Gene Information

• Gene Name: NELL2 NEL-like 2 (chicken) [ Homo sapiens ]
• Official Symbol: NELL2
• Synonyms: NELL2; NEL-like 2 (chicken); nel (chicken) like 2; protein kinase C-binding protein NELL2; NRP2
• Gene ID: 4753
• mRNA Refseq: NM_001145107
• Protein Refseq: NP_001138579
• MIM: 602320
• Uniprot ID: Q99435
• Chromosome Location: 12q12
• Function: calcium ion binding; calcium ion binding; protein binding; structural molecule activity; structural molecule activity