"NFIL3" Related Products

Expand

Recombinant Human NFIL3 protein, T7/His-tagged

Cat.No.: NFIL3-150H
Product Overview: Recombinant human NFIL3 cDNA (461 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGSQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEEL LLSEGSVGKNKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSS VEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGNSFSGYSHSPPLLQVNRSSSN SPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEF EATQKLSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: NFIL3 nuclear factor, interleukin 3 regulated [ Homo sapiens ]
Official Symbol: NFIL3
Synonyms: NFIL3; nuclear factor, interleukin 3 regulated; IL3BP1; nuclear factor interleukin-3-regulated protein; E4BP4; NF IL3A; NFIL3A; E4 promoter-binding protein 4; interleukin-3-binding protein 1; transcriptional activator NF-IL3A; nuclear factor interleukin 3 regulated protein; interleukin-3 promoter transcriptional activator; NF-IL3A;
Gene ID: 4783
mRNA Refseq: NM_005384
Protein Refseq: NP_005375
MIM: 605327
UniProt ID: Q16649
Chromosome Location: 9q22
Function: DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II regulatory region sequence-specific DNA binding; protein dimerizat

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.