Recombinant Human NMT2 protein, GST-tagged

Cat.No. : NMT2-112H
Product Overview : Recombinant Human NMT2(1 a.a. - 498 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-498 a.a.
Description : This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl group to the N-terminal glycine residue of many signaling proteins, including the human immunodeficiency virus type 1 (HIV-1) proteins, Gag and Nef. Alternative splicing results in multiple transcript variants.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 80.52 kDa
AA Sequence : MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSASDSQEI KIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQE PYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLV GFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPIATCRYWH RSLNPKKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLKQFHLAPVMDEEEVAH WFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLDLMSDALILAKSKGFD VFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name NMT2 N-myristoyltransferase 2 [ Homo sapiens ]
Official Symbol NMT2
Synonyms NMT2; N-myristoyltransferase 2; glycylpeptide N-tetradecanoyltransferase 2; NMT 2; type II N-myristoyltransferase; peptide N-myristoyltransferase 2; myristoyl-CoA:protein N-myristoyltransferase 2;
Gene ID 9397
mRNA Refseq NM_004808
Protein Refseq NP_004799
MIM 603801
UniProt ID O60551
Chromosome Location 10p13
Pathway Assembly of HIV virion, organism-specific biosystem; Disease, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; Late Phase of HIV Life Cycle, organism-specific biosystem; Membrane binding and targetting of GAG proteins, organism-specific biosystem; Synthesis and organization of GAG, GAGPOL polyproteins, organism-specific biosystem;
Function catalytic activity; glycylpeptide N-tetradecanoyltransferase activity; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NMT2 Products

Required fields are marked with *

My Review for All NMT2 Products

Required fields are marked with *

0
cart-icon