Recombinant Human NMT2 protein, GST-tagged

• Cat.No.: NMT2-112H
• Product Overview: Recombinant Human NMT2(1 a.a. - 498 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-498 a.a.
• Description: This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl group to the N-terminal glycine residue of many signaling proteins, including the human immunodeficiency virus type 1 (HIV-1) proteins, Gag and Nef. Alternative splicing results in multiple transcript variants.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 80.52 kDa
• AA Sequence: MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSASDSQEI KIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQE PYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLV GFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPIATCRYWH RSLNPKKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLKQFHLAPVMDEEEVAH WFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLDLMSDALILAKSKGFD VFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: NMT2 N-myristoyltransferase 2 [ Homo sapiens ]
• Official Symbol: NMT2
• Synonyms: NMT2; N-myristoyltransferase 2; glycylpeptide N-tetradecanoyltransferase 2; NMT 2; type II N-myristoyltransferase; peptide N-myristoyltransferase 2; myristoyl-CoA:protein N-myristoyltransferase 2
• Gene ID: 9397
• mRNA Refseq: NM_004808
• Protein Refseq: NP_004799
• MIM: 603801
• UniProt ID: O60551
• Chromosome Location: 10p13
• Pathway: Assembly of HIV virion, organism-specific biosystem; Disease, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; Late Phase of HIV Life Cycle, organism-specific biosystem; Membrane binding and targetting of GAG proteins, organism-specific biosystem; Synthesis and organization of GAG, GAGPOL polyproteins, organism-specific biosystem
• Function: catalytic activity; glycylpeptide N-tetradecanoyltransferase activity; transferase activity, transferring acyl groups