Recombinant Human NMT2 protein, GST-tagged
Cat.No. : | NMT2-112H |
Product Overview : | Recombinant Human NMT2(1 a.a. - 498 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-498 a.a. |
Description : | This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl group to the N-terminal glycine residue of many signaling proteins, including the human immunodeficiency virus type 1 (HIV-1) proteins, Gag and Nef. Alternative splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 80.52 kDa |
AA Sequence : | MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSASDSQEI KIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQE PYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLV GFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPIATCRYWH RSLNPKKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLKQFHLAPVMDEEEVAH WFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLDLMSDALILAKSKGFD VFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NMT2 N-myristoyltransferase 2 [ Homo sapiens ] |
Official Symbol | NMT2 |
Synonyms | NMT2; N-myristoyltransferase 2; glycylpeptide N-tetradecanoyltransferase 2; NMT 2; type II N-myristoyltransferase; peptide N-myristoyltransferase 2; myristoyl-CoA:protein N-myristoyltransferase 2; |
Gene ID | 9397 |
mRNA Refseq | NM_004808 |
Protein Refseq | NP_004799 |
MIM | 603801 |
UniProt ID | O60551 |
Chromosome Location | 10p13 |
Pathway | Assembly of HIV virion, organism-specific biosystem; Disease, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; Late Phase of HIV Life Cycle, organism-specific biosystem; Membrane binding and targetting of GAG proteins, organism-specific biosystem; Synthesis and organization of GAG, GAGPOL polyproteins, organism-specific biosystem; |
Function | catalytic activity; glycylpeptide N-tetradecanoyltransferase activity; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
NMT2-112H | Recombinant Human NMT2 protein, GST-tagged | +Inquiry |
NMT2-826H | Recombinant Human N-myristoyltransferase 2, T7-tagged | +Inquiry |
NMT2-10755M | Recombinant Mouse NMT2 Protein | +Inquiry |
NMT2-3434H | Recombinant Human NMT2 protein, His-tagged | +Inquiry |
NMT2-1522H | Recombinant Human NMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMT2-3782HCL | Recombinant Human NMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMT2 Products
Required fields are marked with *
My Review for All NMT2 Products
Required fields are marked with *
0
Inquiry Basket