"NMT2" Related Products

Expand
Expand

Recombinant Human NMT2 protein, GST-tagged

Cat.No. : NMT2-112H
Product Overview : Recombinant Human NMT2(1 a.a. - 498 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl group to the N-terminal glycine residue of many signaling proteins, including the human immunodeficiency virus type 1 (HIV-1) proteins, Gag and Nef. Alternative splicing results in multiple transcript variants.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 80.52 kDa
AA Sequence : MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSASDSQEI KIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQE PYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLV GFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPIATCRYWH RSLNPKKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLKQFHLAPVMDEEEVAH WFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLDLMSDALILAKSKGFD VFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : NMT2 N-myristoyltransferase 2 [ Homo sapiens ]
Official Symbol : NMT2
Synonyms : NMT2; N-myristoyltransferase 2; glycylpeptide N-tetradecanoyltransferase 2; NMT 2; type II N-myristoyltransferase; peptide N-myristoyltransferase 2; myristoyl-CoA:protein N-myristoyltransferase 2;
Gene ID : 9397
mRNA Refseq : NM_004808
Protein Refseq : NP_004799
MIM : 603801
UniProt ID : O60551
Chromosome Location : 10p13
Pathway : Assembly of HIV virion, organism-specific biosystem; Disease, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; Late Phase of HIV Life Cycle, organism-specific biosystem; Membrane binding and targetting of GAG proteins, organism-specific biosystem; Synthesis and organization of GAG, GAGPOL polyproteins, organism-specific biosystem;
Function : catalytic activity; glycylpeptide N-tetradecanoyltransferase activity; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.