Recombinant Human NRF1

• Cat.No.: NRF1-30415TH
• Product Overview: Recombinant fragment of Human NRF1 with a proprietary tag; predicted MWt 34.98 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 85 amino acids
• Description: This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1.
• Molecular Weight: 34.980kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed with strongest expression in skeletal muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ
• Sequence Similarities: Belongs to the NRF1/Ewg family.

Gene Information

• Gene Name: NRF1 nuclear respiratory factor 1 [ Homo sapiens ]
• Official Symbol: NRF1
• Synonyms: NRF1; nuclear respiratory factor 1; alpha palindromic binding protein; ALPHA PAL; EWG
• Gene ID: 4899
• mRNA Refseq: NM_001040110
• Protein Refseq: NP_001035199
• MIM: 600879
• Uniprot ID: Q16656
• Chromosome Location: 7q32
• Pathway: Energy Metabolism, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Mitochondrial Gene Expression, organism-specific biosystem
• Function: DNA binding