Recombinant Human NUDT10, His-tagged

Cat.No. : NUDT10-28046TH
Product Overview : Recombinant full length Human NUDT10 with a C terminal His tag; 172 amino acids with tag, Predicted MWt 19.5kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 164 amino acids
Description : NUDT10 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (Hidaka et al.
Conjugation : HIS
Molecular Weight : 19.500kDa inclusive of tags
Tissue specificity : Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is widely expressed.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDPLEHHHHHH
Sequence Similarities : Belongs to the Nudix hydrolase family. DIPP subfamily.Contains 1 nudix hydrolase domain.
Gene Name NUDT10 nudix (nucleoside diphosphate linked moiety X)-type motif 10 [ Homo sapiens ]
Official Symbol NUDT10
Synonyms NUDT10; nudix (nucleoside diphosphate linked moiety X)-type motif 10; diphosphoinositol polyphosphate phosphohydrolase 3-alpha; DIPP3a; hDIPP3alpha;
Gene ID 170685
mRNA Refseq NM_153183
Protein Refseq NP_694853
MIM 300527
Uniprot ID Q8NFP7
Chromosome Location Xp11.22-p11.1
Function diphosphoinositol-polyphosphate diphosphatase activity; hydrolase activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT10 Products

Required fields are marked with *

My Review for All NUDT10 Products

Required fields are marked with *

0
cart-icon
0
compare icon