Recombinant Human OBFC2A Protein (1-204 aa), His-SUMO-tagged
Cat.No. : | OBFC2A-1094H |
Product Overview : | Recombinant Human OBFC2A Protein (1-204 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-204 aa |
Description : | Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 38.4 kDa |
AA Sequence : | MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NABP1 nucleic acid binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | OBFC2A |
Synonyms | NABP1; SSB2; OBFC2A; SOSS-B2; |
Gene ID | 64859 |
mRNA Refseq | NM_001031716 |
Protein Refseq | NP_001026886 |
MIM | 612103 |
UniProt ID | Q96AH0 |
◆ Recombinant Proteins | ||
OBFC2A-1094H | Recombinant Human OBFC2A Protein (1-204 aa), His-SUMO-tagged | +Inquiry |
OBFC2A-2969R | Recombinant Rhesus Macaque OBFC2A Protein, His (Fc)-Avi-tagged | +Inquiry |
OBFC2A-3151R | Recombinant Rhesus monkey OBFC2A Protein, His-tagged | +Inquiry |
OBFC2A-1436H | Recombinant Human OBFC2A, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OBFC2A Products
Required fields are marked with *
My Review for All OBFC2A Products
Required fields are marked with *
0
Inquiry Basket