Recombinant Human OMD protein, His-tagged
| Cat.No. : | OMD-3100H |
| Product Overview : | Recombinant Human OMD protein(200-421 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | August 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 200-421 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQE |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | OMD osteomodulin [ Homo sapiens ] |
| Official Symbol | OMD |
| Synonyms | OMD; osteomodulin; osteoadherin; osteoadherin proteoglycan; SLRR2C; KSPG osteomodulin; keratan sulfate proteoglycan osteomodulin; OSAD; |
| mRNA Refseq | NM_005014 |
| Protein Refseq | NP_005005 |
| UniProt ID | Q99983 |
| Gene ID | 4958 |
| ◆ Recombinant Proteins | ||
| Omd-870M | Recombinant Mouse Omd Protein, His-tagged | +Inquiry |
| Omd-947M | Active Recombinant Mouse Omd | +Inquiry |
| OMD-251H | Recombinant Human OMD Protein, His-tagged | +Inquiry |
| Omd-10605M | Recombinant Mouse Omd Protein, His (Fc)-Avi-tagged | +Inquiry |
| OMD-3846R | Recombinant Rat OMD Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| OMD-137C | Native Chicken Ovomucoid | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OMD-2385MCL | Recombinant Mouse OMD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OMD Products
Required fields are marked with *
My Review for All OMD Products
Required fields are marked with *



