Recombinant Human OR7D4 protein, His-KSI-tagged
Cat.No. : | OR7D4-6363H |
Product Overview : | Recombinant Human OR7D4 protein(Q8NG98)(161-197aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 161-197a.a. |
Tag : | His-KSI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LLMKRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNI |
Gene Name | OR7D4 olfactory receptor, family 7, subfamily D, member 4 [ Homo sapiens ] |
Official Symbol | OR7D4 |
Synonyms | OR7D4; olfactory receptor, family 7, subfamily D, member 4; OR7D4P; olfactory receptor 7D4; hg105; OR19 B; olfactory receptor OR19-7; odorant receptor family 7 subfamily D member 4 RT; olfactory receptor, family 7, subfamily D, member 4 pseudogene; OR19B; OR19-7; OR19-B; |
Gene ID | 125958 |
mRNA Refseq | NM_001005191 |
Protein Refseq | NP_001005191 |
MIM | 611538 |
UniProt ID | Q8NG98 |
◆ Recombinant Proteins | ||
OR7D4-3051R | Recombinant Rhesus Macaque OR7D4 Protein, His (Fc)-Avi-tagged | +Inquiry |
OR7D4-3233R | Recombinant Rhesus monkey OR7D4 Protein, His-tagged | +Inquiry |
OR7D4-6363H | Recombinant Human OR7D4 protein, His-KSI-tagged | +Inquiry |
RFL35995HF | Recombinant Full Length Human Olfactory Receptor 7D4(Or7D4) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OR7D4 Products
Required fields are marked with *
My Review for All OR7D4 Products
Required fields are marked with *
0
Inquiry Basket