Recombinant Human OR7D4 protein, His-KSI-tagged

Cat.No. : OR7D4-6363H
Product Overview : Recombinant Human OR7D4 protein(Q8NG98)(161-197aa), fused with N-terminal His and KSI tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&KSI
Protein Length : 161-197a.a.
Tag : His-KSI
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 19.5 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : LLMKRLTFSTGTEIPHFFCEPAQVLKVACSNTLLNNI
Gene Name OR7D4 olfactory receptor, family 7, subfamily D, member 4 [ Homo sapiens ]
Official Symbol OR7D4
Synonyms OR7D4; olfactory receptor, family 7, subfamily D, member 4; OR7D4P; olfactory receptor 7D4; hg105; OR19 B; olfactory receptor OR19-7; odorant receptor family 7 subfamily D member 4 RT; olfactory receptor, family 7, subfamily D, member 4 pseudogene; OR19B; OR19-7; OR19-B;
Gene ID 125958
mRNA Refseq NM_001005191
Protein Refseq NP_001005191
MIM 611538
UniProt ID Q8NG98

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OR7D4 Products

Required fields are marked with *

My Review for All OR7D4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon