"OXCT1" Related Products

Expand
Expand

Recombinant Human OXCT1 protein, T7/His-tagged

Cat.No.: OXCT1-215H
Product Overview: Recombinant human OXCT1 cDNA (40 - 520aa, derived from BC009001) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGSTSTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIDALLKTG VKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFY TPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFN LPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIERLSIRKEGDGEAKSAKPGDDVRERII KRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLINAGKETVTILPGASFFS SDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKC TLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELWEGLTVDDVQKSTGCDFAVSPKLMPMQQIAN
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: OXCT1 3-oxoacid CoA transferase 1 [ Homo sapiens ]
Official Symbol: OXCT1
Synonyms: OXCT1; 3-oxoacid CoA transferase 1; SCOT; SCOT-s; 3-oxoacid-CoA transferase 1; succinyl CoA:3-oxoacid CoA transferase; succinyl-CoA:3-ketoacid-CoA transferase; OXCT;
Gene ID: 5019
mRNA Refseq: NM_000436
Protein Refseq: NP_000427
MIM: 601424
UniProt ID: P55809
Chromosome Location: 5p13
Pathway: Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Ketone body metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Synthesis and Degradation of Ketone Bodies, organism-specific biosystem;
Function: 3-oxoacid CoA-transferase activity; 3-oxoacid CoA-transferase activity; protein homodimerization activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.