Recombinant Human Papillomavirus HOV6 protein, GST-tagged
Cat.No. : | HOV6-253P |
Product Overview : | Recombinant HPV6 antigen is a 55.6kDa protein covering the full length of HPV6 major capsid, its N-terminus is fused with a GST tag, having a total Mw of 81.6kDa. The HPV6 was Purified by proprietary chromatographic technique. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Papillomavirus |
Source : | E.coli |
Tag : | GST |
Description : | Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV-6 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV-6 large capsid is used as a potential candidate for vaccine development. |
Form : | Sterile filtered clear liquid formulation. PBS and 3M Urea. |
Molecular Mass : | 81.6kDa |
AA sequence : | VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK. |
Purity : | Protein is >95% pure as determined by 10% PAGE (coomassie staining). |
Applications : | Each laboratory should determine an optimum working titer for use in its particular application. |
Usage : | The products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Stability : | Recombinant HPV-6 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
Shipping : | Ice Packs |
Full Length : | Full L. |
◆ Recombinant Proteins | ||
HOV6-253P | Recombinant Human Papillomavirus HOV6 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOV6 Products
Required fields are marked with *
My Review for All HOV6 Products
Required fields are marked with *