Recombinant Human Papillomavirus HPV18 protein, GST-tagged

Cat.No. : HPV18-252P
Product Overview : The Recombinant HPV-18 is a full length large capsid protein having a Mw of 56kDa expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human Papillomavirus
Source : E.coli
Tag : GST
Description : Human papillomavirus family consist of over 200 types. Over than 30 to 40 types of HPV are transferred via sexual contact and infect the anogenital region initiating genital warts. Persistent infection with "high-risk" HPV types results in skin warts and leads to precancerous lesions and invasive cancer. HPV infection is considered as a source for all incidents of cervical cancer. E2, E6, and E7 proteins of HPV-16 and 18 are considered the main viral oncoproteins that take part in cervical cancer. The type-specific antigen epitopes of E2, E6, and E7 proteins of HPV-16 are fused together and expressed in E. coli for diagnostic purpose.
Form : Sterile filtered clear liquid formulation. Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Molecular Mass : 83kDa
AA sequence : VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA.
Purity : Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Usage : The products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Shipping : Ice Packs
Full Length : Full L.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HPV18 Products

Required fields are marked with *

My Review for All HPV18 Products

Required fields are marked with *

0
cart-icon