"PBK" Related Products

Expand
Expand

Recombinant Human PBK protein, T7/His-tagged

Cat.No.: PBK-229H
Product Overview: Recombinant human PBK cDNA (2 – 322 aa, derived from BC015191) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVY LMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKS LNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENM TVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYY AALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: PBK PDZ binding kinase [ Homo sapiens ]
Official Symbol: PBK
Synonyms: PBK; PDZ binding kinase; lymphokine-activated killer T-cell-originated protein kinase; cancer/testis antigen 84; CT84; FLJ14385; Nori 3; SPK; T LAK cell originated protein kinase; TOPK; PDZ-binding kinase; MAPKK-like protein kinase; serine/threonine protein kinase; T-LAK cell-originated protein kinase; spermatogenesis-related protein kinase; Nori-3;
Gene ID: 55872
mRNA Refseq: NM_018492
Protein Refseq: NP_060962
MIM: 611210
UniProt ID: Q96KB5
Chromosome Location: 8p21.2
Function: ATP binding; nucleotide binding; protein binding; protein serine/threonine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.