Recombinant Human PCDHA10 protein, His-tagged

Cat.No. : PCDHA10-2651H
Product Overview : Recombinant Human PCDHA10 protein(276-324 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability June 18, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 276-324 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MMYSFSSLVPPTIRRKFWINERTGEIKVNDAIDFEDSNTYEIHVDVTDK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol PCDHA10
Synonyms PCDHA10; protocadherin alpha 10; CNRS8; protocadherin alpha-10; CNR8; CNRN8; CRNR8; KIAA0345 like 4; ortholog to mouse CNR8; PCDH ALPHA10; PCDH-alpha-10; KIAA0345-like 4; PCDH-ALPHA10;
Gene ID 56139
mRNA Refseq NM_018901
Protein Refseq NP_061724
MIM 606316
UniProt ID Q9Y5I2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCDHA10 Products

Required fields are marked with *

My Review for All PCDHA10 Products

Required fields are marked with *

0
cart-icon
0
compare icon