Recombinant Human PDCD5 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PDCD5-2528H |
| Product Overview : | PDCD5 MS Standard C13 and N15-labeled recombinant protein (NP_004699) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. Pseudogenes have been identified on chromosomes 5 and 12 |
| Molecular Mass : | 14.3 kDa |
| AA Sequence : | MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PDCD5 programmed cell death 5 [ Homo sapiens (human) ] |
| Official Symbol | PDCD5 |
| Synonyms | PDCD5; programmed cell death 5; programmed cell death protein 5; MGC9294; TF1 cell apoptosis related gene 19; TFAR19; TFAR19 novel apoptosis related; TFAR19 novel apoptosis-related; TF1 cell apoptosis-related gene 19; TF-1 cell apoptosis-related protein 19; FLJ42784; |
| Gene ID | 9141 |
| mRNA Refseq | NM_004708 |
| Protein Refseq | NP_004699 |
| MIM | 604583 |
| UniProt ID | O14737 |
| ◆ Recombinant Proteins | ||
| PDCD5-12536M | Recombinant Mouse PDCD5 Protein | +Inquiry |
| PDCD5-4969C | Recombinant Chicken PDCD5 | +Inquiry |
| Pdcd5-4734M | Recombinant Mouse Pdcd5 Protein, Myc/DDK-tagged | +Inquiry |
| PDCD5-378H | Recombinant Human Programmed Cell Death 5 | +Inquiry |
| PDCD5-1807H | Recombinant Human PDCD5 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD5-3360HCL | Recombinant Human PDCD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD5 Products
Required fields are marked with *
My Review for All PDCD5 Products
Required fields are marked with *



