Recombinant Human PDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PDRG1-4099H
• Product Overview: PDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_110442) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May play a role in chaperone-mediated protein folding.
• Molecular Mass: 15.5 kDa
• AA Sequence: MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PDRG1 p53 and DNA-damage regulated 1 [ Homo sapiens (human) ]
• Official Symbol: PDRG1
• Synonyms: PDRG1; p53 and DNA-damage regulated 1; C20orf126, chromosome 20 open reading frame 126; p53 and DNA damage-regulated protein 1; dJ310O13.3; p53 and DNA damage regulated 1; PDRG; C20orf126
• Gene ID: 81572
• mRNA Refseq: NM_030815
• Protein Refseq: NP_110442
• MIM: 610789
• UniProt ID: Q9NUG6