Recombinant Human PDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PDRG1-4099H |
Product Overview : | PDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_110442) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May play a role in chaperone-mediated protein folding. |
Molecular Mass : | 15.5 kDa |
AA Sequence : | MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PDRG1 p53 and DNA-damage regulated 1 [ Homo sapiens (human) ] |
Official Symbol | PDRG1 |
Synonyms | PDRG1; p53 and DNA-damage regulated 1; C20orf126, chromosome 20 open reading frame 126; p53 and DNA damage-regulated protein 1; dJ310O13.3; p53 and DNA damage regulated 1; PDRG; C20orf126; |
Gene ID | 81572 |
mRNA Refseq | NM_030815 |
Protein Refseq | NP_110442 |
MIM | 610789 |
UniProt ID | Q9NUG6 |
◆ Recombinant Proteins | ||
PDRG1-12596M | Recombinant Mouse PDRG1 Protein | +Inquiry |
PDRG1-4359R | Recombinant Rat PDRG1 Protein | +Inquiry |
PDRG1-2858H | Recombinant Human PDRG1, His-tagged | +Inquiry |
PDRG1-4099H | Recombinant Human PDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDRG1-3363R | Recombinant Rhesus monkey PDRG1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDRG1-3320HCL | Recombinant Human PDRG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDRG1 Products
Required fields are marked with *
My Review for All PDRG1 Products
Required fields are marked with *
0
Inquiry Basket