Recombinant Human PDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PDRG1-4099H |
| Product Overview : | PDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_110442) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | May play a role in chaperone-mediated protein folding. |
| Molecular Mass : | 15.5 kDa |
| AA Sequence : | MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PDRG1 p53 and DNA-damage regulated 1 [ Homo sapiens (human) ] |
| Official Symbol | PDRG1 |
| Synonyms | PDRG1; p53 and DNA-damage regulated 1; C20orf126, chromosome 20 open reading frame 126; p53 and DNA damage-regulated protein 1; dJ310O13.3; p53 and DNA damage regulated 1; PDRG; C20orf126; |
| Gene ID | 81572 |
| mRNA Refseq | NM_030815 |
| Protein Refseq | NP_110442 |
| MIM | 610789 |
| UniProt ID | Q9NUG6 |
| ◆ Recombinant Proteins | ||
| PDRG1-2506Z | Recombinant Zebrafish PDRG1 | +Inquiry |
| PDRG1-3363R | Recombinant Rhesus monkey PDRG1 Protein, His-tagged | +Inquiry |
| Pdrg1-4778M | Recombinant Mouse Pdrg1 Protein, Myc/DDK-tagged | +Inquiry |
| PDRG1-372H | Recombinant Human PDRG1, His tagged | +Inquiry |
| PDRG1-1271H | Recombinant Human PDRG1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDRG1-3320HCL | Recombinant Human PDRG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDRG1 Products
Required fields are marked with *
My Review for All PDRG1 Products
Required fields are marked with *
