Recombinant Human PET117 Protein, His-tagged
| Cat.No. : | PET117-2308H |
| Product Overview : | Recombinant Human PET117 Protein(Q6UWS5)(23-81 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-81 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 8 kDa |
| AASequence : | VHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAEREKMLLAKGSQKS |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.1-1.0 mg/ml |
| ◆ Recombinant Proteins | ||
| PET117-3374R | Recombinant Rhesus monkey PET117 Protein, His-tagged | +Inquiry |
| PET117-2307H | Recombinant Human PET117, His-tagged | +Inquiry |
| PET117-3192R | Recombinant Rhesus Macaque PET117 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PET117-7578Z | Recombinant Zebrafish PET117 | +Inquiry |
| PET117-18H | Recombinant Human PET117 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PET117 Products
Required fields are marked with *
My Review for All PET117 Products
Required fields are marked with *
Recently Viewed
