Recombinant Human PFDN1 protein, T7-tagged

Cat.No. : PFDN1-192H
Product Overview : Recombinant human PFDN1 (122 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 122 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNM YEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name PFDN1 prefoldin subunit 1 [ Homo sapiens ]
Official Symbol PFDN1
Synonyms PFDN1; prefoldin subunit 1; prefoldin 1; PFD1; PDF;
Gene ID 5201
mRNA Refseq NM_002622
Protein Refseq NP_002613
MIM 604897
UniProt ID O60925
Chromosome Location 5q31
Pathway Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function sequence-specific DNA binding transcription factor activity; unfolded protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PFDN1 Products

Required fields are marked with *

My Review for All PFDN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon