Recombinant Human PFDN1 protein, T7-tagged

• Cat.No.: PFDN1-192H
• Product Overview: Recombinant human PFDN1 (122 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 122 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNM YEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: PFDN1 prefoldin subunit 1 [ Homo sapiens ]
• Official Symbol: PFDN1
• Synonyms: PFDN1; prefoldin subunit 1; prefoldin 1; PFD1; PDF
• Gene ID: 5201
• mRNA Refseq: NM_002622
• Protein Refseq: NP_002613
• MIM: 604897
• UniProt ID: O60925
• Chromosome Location: 5q31
• Pathway: Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem
• Function: sequence-specific DNA binding transcription factor activity; unfolded protein binding