Recombinant Human PFDN1 protein, T7-tagged
Cat.No. : | PFDN1-192H |
Product Overview : | Recombinant human PFDN1 (122 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 122 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNM YEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | PFDN1 prefoldin subunit 1 [ Homo sapiens ] |
Official Symbol | PFDN1 |
Synonyms | PFDN1; prefoldin subunit 1; prefoldin 1; PFD1; PDF; |
Gene ID | 5201 |
mRNA Refseq | NM_002622 |
Protein Refseq | NP_002613 |
MIM | 604897 |
UniProt ID | O60925 |
Chromosome Location | 5q31 |
Pathway | Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem; |
Function | sequence-specific DNA binding transcription factor activity; unfolded protein binding; |
◆ Recombinant Proteins | ||
PFDN1-1280H | Recombinant Human PFDN1 protein, His-tagged | +Inquiry |
PFDN1-4741C | Recombinant Chicken PFDN1 | +Inquiry |
PFDN1-3197R | Recombinant Rhesus Macaque PFDN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pfdn1-1009M | Recombinant Mouse PFDN1 protein(Met1-Gln122), His-tagged | +Inquiry |
PFDN1-192H | Recombinant Human PFDN1 protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFDN1-3281HCL | Recombinant Human PFDN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFDN1 Products
Required fields are marked with *
My Review for All PFDN1 Products
Required fields are marked with *